Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Casp2 Rabbit Polyclonal Antibody (HRP)

Casp2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Casp, Ich-, Nedd, ICH-1, Nedd2, CASP-2, NEDD-2

UniProt

P29594

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Casp2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DNANCPSLQNKPKMFFIQACRGDETDRGVDQQDGKNHTQSPGCEESDAGK

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_031636

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNF Receptor II/TNFRSF1B Rabbit Polyclonal Antibody (FITC)
orb2599523 100 µg

TNF Receptor II/TNFRSF1B Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Rat receptor activator of nuclear factor-kB ligand antibody (RANKL-Ab) ELISA Kit
YP-W39079-01 48 Tests

Rat receptor activator of nuclear factor-kB ligand antibody (RANKL-Ab) ELISA Kit

Sign In for Pricing
View Details
Rat receptor activator of nuclear factor-kB ligand antibody (RANKL-Ab) ELISA Kit
YP-W39079-02 96 Tests

Rat receptor activator of nuclear factor-kB ligand antibody (RANKL-Ab) ELISA Kit

Sign In for Pricing
View Details
OAS2 Rabbit Polyclonal Antibody
orb629500-01 50 µg

OAS2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OAS2 Rabbit Polyclonal Antibody
orb629500-02 100 µg

OAS2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TMPRSS3 siRNA (Human)
MBS8201003-01 15 nmol

TMPRSS3 siRNA (Human)

Sign In for Pricing
View Details