Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AXL Rabbit Polyclonal Antibody (FITC)

AXL Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ARK, UFO, JTK11, Tyro7

UniProt

P30530

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human AXL

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QPDPKDSCSCLTAAEVHPAGRYVLCPSTTPSPAQPADRGSPAAPGQEDGA

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

97kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_001690

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Escherichia coli O6:K15:H31 Spermidine export protein MdtJ (mdtJ)
orb2922014-01 20 µg

Recombinant Escherichia coli O6:K15:H31 Spermidine export protein MdtJ (mdtJ)

Sign In for Pricing
View Details
Recombinant Escherichia coli O6:K15:H31 Spermidine export protein MdtJ (mdtJ)
orb2922014-02 100 µg

Recombinant Escherichia coli O6:K15:H31 Spermidine export protein MdtJ (mdtJ)

Sign In for Pricing
View Details
G6Pase-α shRNA (m) Lentiviral Particles
sc-145294-V 200 µL

G6Pase-α shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Rabbit Polyclonal DIA1 Antibody
NBP3-10632-100ul 100 µL

Rabbit Polyclonal DIA1 Antibody

Sign In for Pricing
View Details
CHBB100 Absorbent Pads
143500 100 Box (100 Sheet (s) x 1 Pack)

CHBB100 Absorbent Pads

Sign In for Pricing
View Details
RPL7AP19 sgRNA CRISPR Lentivector (Human) (Target 1)
K1883202 1.0 µg DNA

RPL7AP19 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details