Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AXL Rabbit Polyclonal Antibody (FITC)

AXL Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ARK, UFO, JTK11, Tyro7

UniProt

P30530

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human AXL

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QPDPKDSCSCLTAAEVHPAGRYVLCPSTTPSPAQPADRGSPAAPGQEDGA

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

97kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_001690

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Clk2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6111306 1.0 µg DNA

Clk2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
TAAR8 Protein Vector (Human) (pPB-N-His)
PV134483 500 ng

TAAR8 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
PNLIPRP1 Human shRNA Lentiviral Particle (Locus ID 5407)
TL310327V 500 µL Each

PNLIPRP1 Human shRNA Lentiviral Particle (Locus ID 5407)

Sign In for Pricing
View Details
RNF207 Human shRNA Plasmid Kit (Locus ID 388591)
TL318445 1 Kit

RNF207 Human shRNA Plasmid Kit (Locus ID 388591)

Sign In for Pricing
View Details
BDNF Lentiviral Activation Particles (h)
sc-400029-LAC 200 µL

BDNF Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Dtna 3'UTR Luciferase Stable Cell Line
TU105420 1.0 mL

Dtna 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details