Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AXL Rabbit Polyclonal Antibody (HRP)

AXL Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ARK, UFO, JTK11, Tyro7

UniProt

P30530

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human AXL

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QPDPKDSCSCLTAAEVHPAGRYVLCPSTTPSPAQPADRGSPAAPGQEDGA

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

97kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_001690

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gpr135 siRNA Oligos set (Rat)
22503176 3x 5 nmol

Gpr135 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Arginase 2 (ARG2) Antibody (FITC)
abx271097-01 200 µL

Arginase 2 (ARG2) Antibody (FITC)

Sign In for Pricing
View Details
Arginase 2 (ARG2) Antibody (FITC)
abx271097-02 1 mL

Arginase 2 (ARG2) Antibody (FITC)

Sign In for Pricing
View Details
(S)-Lisofylline
C4161-1 1 mg

(S)-Lisofylline

Sign In for Pricing
View Details
Human Probable E3 Ubiquitin-Protein Ligase Makorin-2 (MKRN2) ELISA Kit
MBS9715271-01 48 Tests

Human Probable E3 Ubiquitin-Protein Ligase Makorin-2 (MKRN2) ELISA Kit

Sign In for Pricing
View Details
Human Probable E3 Ubiquitin-Protein Ligase Makorin-2 (MKRN2) ELISA Kit
MBS9715271-02 96 Tests

Human Probable E3 Ubiquitin-Protein Ligase Makorin-2 (MKRN2) ELISA Kit

Sign In for Pricing
View Details