Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGB1 Rabbit Polyclonal Antibody (HRP)

HMGB1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HMG1, HMG3, HMG-1, SBP-1

UniProt

P09429

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HMGB1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKAR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002119

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-CBL (Tyr700) Rabbit Polyclonal Antibody (FITC)
orb7229 100 µL

Phospho-CBL (Tyr700) Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Cdkn2aip 3'UTR Luciferase Stable Cell Line
TU103651 1.0 mL

Cdkn2aip 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
XRCC1, ID (XRCC1, DNA repair protein XRCC1, X-ray repair cross-complementing protein 1) (Biotin) discontinued
043931-Biotin 200 µL

XRCC1, ID (XRCC1, DNA repair protein XRCC1, X-ray repair cross-complementing protein 1) (Biotin) discontinued

Sign In for Pricing
View Details
LD-LST-A10/X-ray Fluorescence Sulfur in Oil Analyzer
LD-LST-A10 1 Each

LD-LST-A10/X-ray Fluorescence Sulfur in Oil Analyzer

Sign In for Pricing
View Details
ACADM, ID (Medium-chain Specific Acyl-CoA Dehydrogenase, Mitochondrial, MCAD) (HRP) discontinued
A0193-15C-HRP 200 µL

ACADM, ID (Medium-chain Specific Acyl-CoA Dehydrogenase, Mitochondrial, MCAD) (HRP) discontinued

Sign In for Pricing
View Details
Protein A/G/L Magnetic Beads
6547-1 1 mL

Protein A/G/L Magnetic Beads

Sign In for Pricing
View Details