Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYOZ2, Human (His)

MYOZ2 is a member of the Myozenin family that binds to Z-line proteins, including α-actin and γ-filamin, and contributes to the localization of calcineurin signals within the sarcomere. It plays a key role in regulating calcineurin signaling and has been shown to be involved in muscle regulatory mechanisms and myofibril formation. MYOZ2 Protein, Human (His) is the recombinant human-derived MYOZ2 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MYOZ2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/myoz2-protein-human-his.html

Smiles

MLSHNTMMKQRKQQATAIMKEVHGNDVDGMDLGKKVSIPRDIMLEELSHLSNRGARLFKMRQRRSDKYTFENFQYQSRAQINHSIAMQNGKVDGSNLEGGSQQAPLTPPNTPDPRSPPNPDNIAPGYSGPLKEIPPEKFNTTAVPKYYQSPWEQAISNDPELLEALYPKLFKPEGKAELPDYRSFNRVATPFGGFEKASRMVKFKVPDFELLLLTDPRFMSFVNPLSGRRSFNRTPKGWISENIPIVITTEPTDDTTVPESEDL

Molecular Formula

51778 (Gene_ID) Q9NPC6 (M1-L264) (Accession)

Molecular Weight

Approximately 38 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCD4 Human Gene Knockout Kit (CRISPR)
KN401291 1 Kit

ABCD4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Rat CGA protein (His tag)
PDER100232-01 20 µg

Recombinant Rat CGA protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat CGA protein (His tag)
PDER100232-02 100 µg

Recombinant Rat CGA protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat CGA protein (His tag)
PDER100232-03 500 µg

Recombinant Rat CGA protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat CGA protein (His tag)
PDER100232-04 1 mg

Recombinant Rat CGA protein (His tag)

Sign In for Pricing
View Details
Frozen Tissue Blocks, Pleura
CB501802 1 Block

Frozen Tissue Blocks, Pleura

Sign In for Pricing
View Details