Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Atg12 Rabbit Polyclonal Antibody (HRP)

Atg12 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Apg12l

UniProt

Q2TBJ5

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TRTVQALIDFIRKFLRLLASEQLFIYVNQSFAPSPDQEVGTLYECFGSDG

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

15kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Yeast, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_001033584

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ficolin 3, FCN3 ELISA KIT
E0329Hu-01 48 Well

Human ficolin 3, FCN3 ELISA KIT

Sign In for Pricing
View Details
Human ficolin 3, FCN3 ELISA KIT
E0329Hu-02 96 Well

Human ficolin 3, FCN3 ELISA KIT

Sign In for Pricing
View Details
Human ficolin 3, FCN3 ELISA KIT
E0329Hu-03 5x 96 Tests

Human ficolin 3, FCN3 ELISA KIT

Sign In for Pricing
View Details
Human ficolin 3, FCN3 ELISA KIT
E0329Hu-04 10x 96 Tests

Human ficolin 3, FCN3 ELISA KIT

Sign In for Pricing
View Details
Tubulin alpha-3C/D Chain (Alpha-tubulin 3C/D, TUBA3C, TUBA3D, Alpha-tubulin 2, Tubulin alpha-2 Chain, TUBA2, bA408E5.3) (Biotin)
134879-Biotin 100 µL

Tubulin alpha-3C/D Chain (Alpha-tubulin 3C/D, TUBA3C, TUBA3D, Alpha-tubulin 2, Tubulin alpha-2 Chain, TUBA2, bA408E5.3) (Biotin)

Sign In for Pricing
View Details
RNF19B, ID (RNF19B, IBRDC3, NKLAM, E3 ubiquitin-protein ligase RNF19B, IBR domain-containing protein 3, Natural killer lytic-associated molecule, RING finger protein 19B) (MaxLight 405) discontinued
041130-ML405 100 µL

RNF19B, ID (RNF19B, IBRDC3, NKLAM, E3 ubiquitin-protein ligase RNF19B, IBR domain-containing protein 3, Natural killer lytic-associated molecule, RING finger protein 19B) (MaxLight 405) discontinued

Sign In for Pricing
View Details