Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tmem173 Rabbit Polyclonal Antibody (Biotin)

Tmem173 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RSTING, Tmem173, RGD1562552

UniProt

I3P832

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Tmem173

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LFAMSQDGKAGFSREDRLEQAKLFCRTLEEILADVPESRNHCRLIVYQES

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001102592

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IX 207-887 10mg
A13349-10 10 mg

IX 207-887 10mg

Sign In for Pricing
View Details
PRRG1 Rabbit Polyclonal Antibody (Fluoro550)
orb3093344 100 µg

PRRG1 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
DNER, CT (DNER, BET, Delta and Notch-like epidermal growth factor-related receptor) (APC)
MBS6292961-01 0.2 mL

DNER, CT (DNER, BET, Delta and Notch-like epidermal growth factor-related receptor) (APC)

Sign In for Pricing
View Details
DNER, CT (DNER, BET, Delta and Notch-like epidermal growth factor-related receptor) (APC)
MBS6292961-02 5x 0.2 mL

DNER, CT (DNER, BET, Delta and Notch-like epidermal growth factor-related receptor) (APC)

Sign In for Pricing
View Details
FAM5C (BRINP3) Human qPCR Template Standard (NM_199051)
HK212517 1 Kit

FAM5C (BRINP3) Human qPCR Template Standard (NM_199051)

Sign In for Pricing
View Details
BAG4 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
12984156 3x 1.0 µg DNA

BAG4 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details