Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tmem173 Rabbit Polyclonal Antibody (Biotin)

Tmem173 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RSTING, Tmem173, RGD1562552

UniProt

I3P832

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Tmem173

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LFAMSQDGKAGFSREDRLEQAKLFCRTLEEILADVPESRNHCRLIVYQES

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001102592

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POLR2D Antibody
OAAN00577-50UL 50 µL

POLR2D Antibody

Sign In for Pricing
View Details
Caprisil NH2-D HPLC Column, 5 µm, 100 Å, CA553-AD x 50 mm
CA353-AD 5 µm

Caprisil NH2-D HPLC Column, 5 µm, 100 Å, CA553-AD x 50 mm

Sign In for Pricing
View Details
Stim1 (A-8) Alexa Fluor® 546
sc-166840 AF546 200 µg/mL

Stim1 (A-8) Alexa Fluor® 546

Sign In for Pricing
View Details
CZC54252 hydrochloride 100mg
A15510-100 100 mg

CZC54252 hydrochloride 100mg

Sign In for Pricing
View Details
CTNNBL1 AAV Vector (Human) (CMV)
17076101 1 µg

CTNNBL1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Phospholipase A2 Receptor 1 (PLA2R1)
MBS2110100-01 0.1 mL

PE-Linked Monoclonal Antibody to Phospholipase A2 Receptor 1 (PLA2R1)

Sign In for Pricing
View Details