Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TLR2 Rabbit Polyclonal Antibody (FITC)

TLR2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TIL4, CD282

UniProt

O60603

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TLR2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EIDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFVDVTSSVECLEL

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

90kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_003255

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VKORC1, NT (VKORC1, VKOR, Vitamin K epoxide reductase complex subunit 1, Vitamin K1 2,3-epoxide reductase subunit 1) (MaxLight 405) discontinued
043761-ML405 100 µL

VKORC1, NT (VKORC1, VKOR, Vitamin K epoxide reductase complex subunit 1, Vitamin K1 2,3-epoxide reductase subunit 1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
ER780 Anti-Human CD73 Antibody [AD2]
MBS2568484-01 20 Tests

ER780 Anti-Human CD73 Antibody [AD2]

Sign In for Pricing
View Details
ER780 Anti-Human CD73 Antibody [AD2]
MBS2568484-02 100 Tests

ER780 Anti-Human CD73 Antibody [AD2]

Sign In for Pricing
View Details
ER780 Anti-Human CD73 Antibody [AD2]
MBS2568484-03 2x 100 Tests

ER780 Anti-Human CD73 Antibody [AD2]

Sign In for Pricing
View Details
ER780 Anti-Human CD73 Antibody [AD2]
MBS2568484-04 10x 100 Tests

ER780 Anti-Human CD73 Antibody [AD2]

Sign In for Pricing
View Details
NLRP3 (FCU, MWS, FCAS, Cias1, Mmig1, NALP3, PYRIN-containing APAF1-like Protein 1, PYPAF1, AII/AVP, AGTAVPRL) (PE)
MBS6429212-01 0.1 mL

NLRP3 (FCU, MWS, FCAS, Cias1, Mmig1, NALP3, PYRIN-containing APAF1-like Protein 1, PYPAF1, AII/AVP, AGTAVPRL) (PE)

Sign In for Pricing
View Details