Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATG10 Rabbit Polyclonal Antibody (Biotin)

ATG10 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

APG10, APG10L, pp12616

UniProt

Q9H0Y0

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ATG10

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FFVLHPCKTNEFMTPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001124500

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bovine Mannose-binding protein 1, His, Yeast-100ug
QP9267-ye-100ug 100ug

Recombinant Bovine Mannose-binding protein 1, His, Yeast-100ug

Sign In for Pricing
View Details
Human CST11 qPCR Primer Pair
QH63769S 200 Tests

Human CST11 qPCR Primer Pair

Sign In for Pricing
View Details
Mouse Monoclonal Glut1 Antibody (GLUT1/2476) [Alexa Fluor 350]
NBP2-75787AF350 0.1 mL

Mouse Monoclonal Glut1 Antibody (GLUT1/2476) [Alexa Fluor 350]

Sign In for Pricing
View Details
Recombinant Salmonella gallinarum Elongation factor P (efp)
MBS1107332-01 0.02 mg (E-Coli)

Recombinant Salmonella gallinarum Elongation factor P (efp)

Sign In for Pricing
View Details
Recombinant Salmonella gallinarum Elongation factor P (efp)
MBS1107332-02 0.1 mg (E-Coli)

Recombinant Salmonella gallinarum Elongation factor P (efp)

Sign In for Pricing
View Details
Recombinant Salmonella gallinarum Elongation factor P (efp)
MBS1107332-03 0.02 mg (Yeast)

Recombinant Salmonella gallinarum Elongation factor P (efp)

Sign In for Pricing
View Details