Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATG16L1 Rabbit Polyclonal Antibody (FITC)

ATG16L1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

IBD10, WDR30, APG16L, ATG16A, ATG16L

UniProt

Q676U5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human ATG16L1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QCVMSGHFDKKIRFWDIRSESIVREMELLGKITALDLNPERTELLSCSRD

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PDCD11 shRNA Plasmid
abx957908-01 150 µg

Human PDCD11 shRNA Plasmid

Sign In for Pricing
View Details
Human PDCD11 shRNA Plasmid
abx957908-02 300 µg

Human PDCD11 shRNA Plasmid

Sign In for Pricing
View Details
Azurocidin/HBP Mouse mAb, BF647 conjugated
orb2979181 100 µL

Azurocidin/HBP Mouse mAb, BF647 conjugated

Sign In for Pricing
View Details
PIC W011-Tri 100-PE-SHEET/3 Safety & Regulatory Compliance Signs & Labels (Adhesive)
827947 3 Sheet (3 Panel (s) x 1 Sheet)

PIC W011-Tri 100-PE-SHEET/3 Safety & Regulatory Compliance Signs & Labels (Adhesive)

Sign In for Pricing
View Details
Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) DPCD Polyclonal Antibody
MBS7188091 Inquire

Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) DPCD Polyclonal Antibody

Sign In for Pricing
View Details
H-Ser-Ile-Gly-Ser-Leu-Ala-Lys-OH trifluoroacetate salt
FS110226-01 25 mg

H-Ser-Ile-Gly-Ser-Leu-Ala-Lys-OH trifluoroacetate salt

Sign In for Pricing
View Details