Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATG16L1 Rabbit Polyclonal Antibody (HRP)

ATG16L1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IBD10, WDR30, APG16L, ATG16A, ATG16L

UniProt

Q676U5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human ATG16L1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QCVMSGHFDKKIRFWDIRSESIVREMELLGKITALDLNPERTELLSCSRD

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADCK3 (COQ8A) (NM_020247) Human Over-expression Lysate
LC402769 20 µg

ADCK3 (COQ8A) (NM_020247) Human Over-expression Lysate

Sign In for Pricing
View Details
RASSF10 (Center) Rabbit Polyclonal Antibody
AP53592PU-N 400 µL

RASSF10 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DOK3 (NM_024872) Human Recombinant Protein
TP322370M 100 µg

DOK3 (NM_024872) Human Recombinant Protein

Sign In for Pricing
View Details
CF®750 Goat Anti-Mouse IgG3 (γ3), 2mg/mL
#20431-250uL 1x 250 µL

CF®750 Goat Anti-Mouse IgG3 (γ3), 2mg/mL

Sign In for Pricing
View Details
Nucleolin (364-5 + NCL/902), CF568 conjugate, 0.1mg/mL
BNC681205-500 1x 500 µL

Nucleolin (364-5 + NCL/902), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LINC02145 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8C7]
TA810701BM 100 µL

LINC02145 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8C7]

Sign In for Pricing
View Details