Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATG16L1 Rabbit Polyclonal Antibody (HRP)

ATG16L1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IBD10, WDR30, APG16L, ATG16A, ATG16L

UniProt

Q676U5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human ATG16L1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QCVMSGHFDKKIRFWDIRSESIVREMELLGKITALDLNPERTELLSCSRD

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LRTOMT activation kit by CRISPRa
GA116559 1 Kit

Human LRTOMT activation kit by CRISPRa

Sign In for Pricing
View Details
GST3 (GSTP1) (NM_000852) Human Over-expression Lysate
LY400300 100 µg

GST3 (GSTP1) (NM_000852) Human Over-expression Lysate

Sign In for Pricing
View Details
SCRN2 Polyclonal Antibody
E-AB-18833-01 20 µL

SCRN2 Polyclonal Antibody

Sign In for Pricing
View Details
SCRN2 Polyclonal Antibody
E-AB-18833-02 60 µL

SCRN2 Polyclonal Antibody

Sign In for Pricing
View Details
SCRN2 Polyclonal Antibody
E-AB-18833-03 120 µL

SCRN2 Polyclonal Antibody

Sign In for Pricing
View Details
SCRN2 Polyclonal Antibody
E-AB-18833-04 200 µL

SCRN2 Polyclonal Antibody

Sign In for Pricing
View Details