Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VTCN1 Rabbit Polyclonal Antibody (HRP)

VTCN1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

B7X, B7H4, B7S1, B7-H4, B7h.5, VCTN1, PRO1291

UniProt

Q7Z7D3

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human VTCN1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIV

Field of Research

Immunology & Inflammation

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_078902

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Fibroblast Growth Factor 6, Basic (FGF6) ELISA Kit
NSL0332Ca 96 Tests

Canine Fibroblast Growth Factor 6, Basic (FGF6) ELISA Kit

Sign In for Pricing
View Details
Topoisomerase II ά
PR306-6ml 6 mL

Topoisomerase II ά

Sign In for Pricing
View Details
Human CYBb (Cytochrome b-245 Beta Polypeptide) ELISA Kit
EK243893 96 Well

Human CYBb (Cytochrome b-245 Beta Polypeptide) ELISA Kit

Sign In for Pricing
View Details
Recombinant Neisseria Gonorrhoeae aroC Protein (aa 1-366) (strain ATCC 700825 / FA 1090)
VAng-Wyb2465-500gEcoli 500 µg (E. coli)

Recombinant Neisseria Gonorrhoeae aroC Protein (aa 1-366) (strain ATCC 700825 / FA 1090)

Sign In for Pricing
View Details
Goat Polyclonal Goat anti-Rat IgG (H+L) Secondary Antibody [PE]
NBP1-72716PE 0.5 mL

Goat Polyclonal Goat anti-Rat IgG (H+L) Secondary Antibody [PE]

Sign In for Pricing
View Details
Mouse Glutamine Synthetase (GS) ELISA Kit
JL48659-01 48 Tests

Mouse Glutamine Synthetase (GS) ELISA Kit

Sign In for Pricing
View Details