Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFRSF4 Rabbit Polyclonal Antibody (HRP)

TNFRSF4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OX40, ACT35, CD134, IMD16, TXGP1L

UniProt

P43489

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TNFRSF4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQ

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_003318

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGLS Peptide - middle region
orb2012189 100 µg

PGLS Peptide - middle region

Sign In for Pricing
View Details
CTSW siRNA (Mouse)
CRM0912-01 15 nmol

CTSW siRNA (Mouse)

Sign In for Pricing
View Details
CTSW siRNA (Mouse)
CRM0912-02 30 nmol

CTSW siRNA (Mouse)

Sign In for Pricing
View Details
Cattle HSPA1A (Heat Shock 70kDa Protein 1A) ELISA Kit
EK247429 96 Well

Cattle HSPA1A (Heat Shock 70kDa Protein 1A) ELISA Kit

Sign In for Pricing
View Details
Frozen Tissue Sections, Thyroid gland
CS613722 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details
Rat Neurofilament medium polypeptide ELISA Kit
MBS288893-01 48 Well

Rat Neurofilament medium polypeptide ELISA Kit

Sign In for Pricing
View Details