Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISG20 Rabbit Polyclonal Antibody (HRP)

ISG20 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CD25, HEM45

UniProt

Q96AZ6

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ISG20

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: STDRLLWREAKLDHCRRVSLRVLSERLLHKSIQNSLLGHSSVEDARATME

Field of Research

Infectious Disease & Virology

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

19 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_002192

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse VDR (Vitamin D Receptor) ELISA Kit
EM23004 96 Tests

Mouse VDR (Vitamin D Receptor) ELISA Kit

Sign In for Pricing
View Details
Hsa-miR-219a-2-3p agomir
HY-R00460A-01 5 nmol

Hsa-miR-219a-2-3p agomir

Sign In for Pricing
View Details
Hsa-miR-219a-2-3p agomir
HY-R00460A-02 20 nmol

Hsa-miR-219a-2-3p agomir

Sign In for Pricing
View Details
Human Annexin A13  (ANXA13) AssayLite Antibody (FITC, RPE, APC, PerCP Conjugate)
30219-05181 1x 75 µg - 3x 30 µg

Human Annexin A13 (ANXA13) AssayLite Antibody (FITC, RPE, APC, PerCP Conjugate)

Sign In for Pricing
View Details
RBFOX3 Antibody
E30AOC001 100 µL

RBFOX3 Antibody

Sign In for Pricing
View Details
1L PETG Square Storage Bottle with Bi-Directional Transfer Cap with TPE Tube (60cm 1/4" ID 7/16" OD), Heat seal , Vent Filter (0.22 μm 4.5cm2), Sterile, 1/pk, 10/cs
CS0016-C51121-DZB060A 1 Each

1L PETG Square Storage Bottle with Bi-Directional Transfer Cap with TPE Tube (60cm 1/4" ID 7/16" OD), Heat seal , Vent Filter (0.22 μm 4.5cm2), Sterile, 1/pk, 10/cs

Sign In for Pricing
View Details