Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD27 Rabbit Polyclonal Antibody (HRP)

CD27 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

T14, S152, Tp55, TNFRSF7, S152. LPFS2

UniProt

P26842

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CD27

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LHQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYRKPEPACSP

Field of Research

Immunology & Inflammation; Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001233

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPC2 Antibody (HRP)
orb242500-01 50 µg

NPC2 Antibody (HRP)

Sign In for Pricing
View Details
NPC2 Antibody (HRP)
orb242500-02 100 µg

NPC2 Antibody (HRP)

Sign In for Pricing
View Details
LIFR discontinued
391091 200 µL

LIFR discontinued

Sign In for Pricing
View Details
Human Zona Pellucida Glycoprotein 2, Sperm Receptor (ZP2) ELISA Kit
MBS457239-01 48 Tests

Human Zona Pellucida Glycoprotein 2, Sperm Receptor (ZP2) ELISA Kit

Sign In for Pricing
View Details
Human Zona Pellucida Glycoprotein 2, Sperm Receptor (ZP2) ELISA Kit
MBS457239-02 96 Tests

Human Zona Pellucida Glycoprotein 2, Sperm Receptor (ZP2) ELISA Kit

Sign In for Pricing
View Details
Human Zona Pellucida Glycoprotein 2, Sperm Receptor (ZP2) ELISA Kit
MBS457239-03 5x 96 Tests

Human Zona Pellucida Glycoprotein 2, Sperm Receptor (ZP2) ELISA Kit

Sign In for Pricing
View Details