Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD28 Rabbit Polyclonal Antibody (FITC)

CD28 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Tp44

UniProt

P10747

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CD28

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_006130

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Eye muscle Anti-body (EMAb) ELISA Kit
NSL0560r 96 Tests

Rat Eye muscle Anti-body (EMAb) ELISA Kit

Sign In for Pricing
View Details
Recombinant Sodalis glossinidius UPF0259 membrane protein SG1383 (SG1383), partial
MBS7077012 Inquire

Recombinant Sodalis glossinidius UPF0259 membrane protein SG1383 (SG1383), partial

Sign In for Pricing
View Details
Aire 3'UTR Lenti-reporter-Luc Vector
11612084 1.0 µg

Aire 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
FAS (Tumor Necrosis Factor Receptor Superfamily Member 6, TNFRSF6, Apo-1 Antigen, Apoptosis-mediating Surface Antigen FAS, FASLG Receptor, CD95, APT1, FAS1, TNFRSF6) (MaxLight 490)
126636-ML490 100 µL

FAS (Tumor Necrosis Factor Receptor Superfamily Member 6, TNFRSF6, Apo-1 Antigen, Apoptosis-mediating Surface Antigen FAS, FASLG Receptor, CD95, APT1, FAS1, TNFRSF6) (MaxLight 490)

Sign In for Pricing
View Details
Goat Aryl hydrocarbon receptor repressor (AHRR) ELISA Kit
MBS7239351-01 48 Well

Goat Aryl hydrocarbon receptor repressor (AHRR) ELISA Kit

Sign In for Pricing
View Details
Goat Aryl hydrocarbon receptor repressor (AHRR) ELISA Kit
MBS7239351-02 96 Well

Goat Aryl hydrocarbon receptor repressor (AHRR) ELISA Kit

Sign In for Pricing
View Details