Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NRP1 Rabbit Polyclonal Antibody (HRP)

NRP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NP1, NRP, BDCA4, CD304, VEGF165R

UniProt

O14786

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NRP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLF

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

72kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001019799

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM38 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI113D3]
TA505981BM 100 µL

TRIM38 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI113D3]

Sign In for Pricing
View Details
Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16, CF647 conjugate, 0.1mg/mL
BNC471633-100 1x 100 µL

Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16, CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytochrome C (Mitochondrial Marker) (CYCS/3128R), CF488A conjugate, 0.1mg/mL
BNC883128-100 1x 100 µL

Cytochrome C (Mitochondrial Marker) (CYCS/3128R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (Tumor-Associated Glycoprotein) (CA72/2869R), CF740 conjugate, 0.1mg/mL
BNC742869-500 1x 500 µL

TAG-72 / CA72.4 (Tumor-Associated Glycoprotein) (CA72/2869R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ION Essentials Ratiometric Calcium - No wash ratiometric calcium assay kit
6000-10 1 Kit

ION Essentials Ratiometric Calcium - No wash ratiometric calcium assay kit

Sign In for Pricing
View Details
LGALS3BP Human Gene Knockout Kit (CRISPR)
KN204918BN 1 Kit

LGALS3BP Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details