Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD4 Rabbit Polyclonal Antibody (Biotin)

CD4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

IMD79, OKT4D, CD4mut

UniProt

P01730

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CD4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VLGGVAGLLLFIGLGIFFCVRCRHRRRQAERMSQIKRLLSEKKTCQCPHR

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_000607

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Mitofusin-1 Antibody FL490 Conjugate
75-162-FL490 200 µL

Anti-Mitofusin-1 Antibody FL490 Conjugate

Sign In for Pricing
View Details
Horse Sn1-Specific Diacylglycerol Lipase Beta (DAGLB) ELISA Kit
MBS9379755-01 48 Well

Horse Sn1-Specific Diacylglycerol Lipase Beta (DAGLB) ELISA Kit

Sign In for Pricing
View Details
Horse Sn1-Specific Diacylglycerol Lipase Beta (DAGLB) ELISA Kit
MBS9379755-02 96 Well

Horse Sn1-Specific Diacylglycerol Lipase Beta (DAGLB) ELISA Kit

Sign In for Pricing
View Details
Horse Sn1-Specific Diacylglycerol Lipase Beta (DAGLB) ELISA Kit
MBS9379755-03 5x 96 Well

Horse Sn1-Specific Diacylglycerol Lipase Beta (DAGLB) ELISA Kit

Sign In for Pricing
View Details
Horse Sn1-Specific Diacylglycerol Lipase Beta (DAGLB) ELISA Kit
MBS9379755-04 10x 96 Well

Horse Sn1-Specific Diacylglycerol Lipase Beta (DAGLB) ELISA Kit

Sign In for Pricing
View Details
LOC51233 Protein Vector (Human) (pPM-C-HA)
PV024071 500 ng

LOC51233 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details