Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD8A Rabbit Polyclonal Antibody (FITC)

CD8A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CD8, p32, Leu2

UniProt

P01732

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CD8A

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENE

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001139345

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cd109 (Cluster of Differentiation 109) ELISA Kit
FY-EM4861 96 Well

Mouse Cd109 (Cluster of Differentiation 109) ELISA Kit

Sign In for Pricing
View Details
MYSM1, NT (MYSM1, KIAA1915, Histone H2A deubiquitinase MYSM1, Myb-like, SWIRM and MPN domain-containing protein 1) (FITC)
MBS6323575-01 0.2 mL

MYSM1, NT (MYSM1, KIAA1915, Histone H2A deubiquitinase MYSM1, Myb-like, SWIRM and MPN domain-containing protein 1) (FITC)

Sign In for Pricing
View Details
MYSM1, NT (MYSM1, KIAA1915, Histone H2A deubiquitinase MYSM1, Myb-like, SWIRM and MPN domain-containing protein 1) (FITC)
MBS6323575-02 5x 0.2 mL

MYSM1, NT (MYSM1, KIAA1915, Histone H2A deubiquitinase MYSM1, Myb-like, SWIRM and MPN domain-containing protein 1) (FITC)

Sign In for Pricing
View Details
CD29 (Integrin beta 1) (FITC) discontinued
C2381-10B-FITC 100 µL

CD29 (Integrin beta 1) (FITC) discontinued

Sign In for Pricing
View Details
B7-1 (CD80) mouse monoclonal antibody, clone MEM-233, Azide Free
SM1742A 1 mg

B7-1 (CD80) mouse monoclonal antibody, clone MEM-233, Azide Free

Sign In for Pricing
View Details
Goat anti-Mouse IgG + IgM, min, cross-reactivity to human IgG or serum proteins
AS16 3475 1 mg

Goat anti-Mouse IgG + IgM, min, cross-reactivity to human IgG or serum proteins

Sign In for Pricing
View Details