Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD8A Rabbit Polyclonal Antibody (HRP)

CD8A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CD8, p32, Leu2

UniProt

P01732

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CD8A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTT

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human

Tested Applications

WB

NCBI Accession Number

NP_001139345

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat CXADR-Like Membrane Protein (CLMP) ELISA Kit
abx391165 96 Tests

Rat CXADR-Like Membrane Protein (CLMP) ELISA Kit

Sign In for Pricing
View Details
Olfr961 Double Nickase Plasmid (m)
sc-434641-NIC 20 µg

Olfr961 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
SCP2, ID (Non-specific Lipid-transfer Protein, Propanoyl-CoA C-acyltransferase, NSL-TP, Sterol Carrier Protein 2, SCP-2, Sterol Carrier Protein X, SCP-X, SCP-chi, SCPX) (MaxLight 550) discontinued
S0519-85A-ML550 100 µL

SCP2, ID (Non-specific Lipid-transfer Protein, Propanoyl-CoA C-acyltransferase, NSL-TP, Sterol Carrier Protein 2, SCP-2, Sterol Carrier Protein X, SCP-X, SCP-chi, SCPX) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Gramd1b 3'UTR GFP Stable Cell Line
TU159078 1.0 mL

Gramd1b 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
FAM83E Polyclonal Antibody, PerCP Conjugated
bs-16016R-PerCP 100 µL

FAM83E Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
BCAS4 discontinued
342067-01 100 µL

BCAS4 discontinued

Sign In for Pricing
View Details