Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IZUMO1R Rabbit Polyclonal Antibody (Biotin)

IZUMO1R Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

JUNO, FOLR4, Folbp3, FR-delta

UniProt

C9JJV3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FOLR4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TCKSNWRGGWDWSQGKNRCPKGAQCLPFSHYFPTPADLCEKTWSNSFKAS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Guinea pig, Human

Tested Applications

WB

NCBI Accession Number

NP_001073955

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® Violet 500 Anti-Mouse CD19 Antibody[1D3]
E-AB-F0986R-01 50 Tests

Elab Fluor® Violet 500 Anti-Mouse CD19 Antibody[1D3]

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Anti-Mouse CD19 Antibody[1D3]
E-AB-F0986R-02 100 Tests

Elab Fluor® Violet 500 Anti-Mouse CD19 Antibody[1D3]

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Anti-Mouse CD19 Antibody[1D3]
E-AB-F0986R-03 2x 100 Tests

Elab Fluor® Violet 500 Anti-Mouse CD19 Antibody[1D3]

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (GP1.4), CF568 conjugate, 0.1mg/mL
BNC680159-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (GP1.4), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CCNK (NM_001099402) Human Over-expression Lysate
LY420439 100 µg

CCNK (NM_001099402) Human Over-expression Lysate

Sign In for Pricing
View Details
Prohibitin (Mitochondrial Marker) (PHB/3230), CF405S conjugate, 0.1mg/mL
BNC043230-500 1x 500 µL

Prohibitin (Mitochondrial Marker) (PHB/3230), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details