Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ICAM1 Rabbit Polyclonal Antibody (HRP)

ICAM1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BB2, CD54, P3.58

UniProt

P05362

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ICAM1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELA

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_000192

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ciprofloxacin HCl (Solution), 50 mL
Q902-50ML 50 mL

Ciprofloxacin HCl (Solution), 50 mL

Sign In for Pricing
View Details
MOL2B, NT (MOB3B, MOBKL2B, MOB kinase activator 3B, Mob1 homolog 2b, Mps one binder kinase activator-like 2B) (AP) discontinued
038537-AP 200 µL

MOL2B, NT (MOB3B, MOBKL2B, MOB kinase activator 3B, Mob1 homolog 2b, Mps one binder kinase activator-like 2B) (AP) discontinued

Sign In for Pricing
View Details
Olr1496 ORF Vector (Rat) (pORF)
ORF072088 1.0 µg DNA

Olr1496 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
PARP11 Rabbit Polyclonal Antibody (BF488)
orb2464676 100 µL

PARP11 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
Esophagus carcer test tissue array, with normal esophagus tissue as control, including TNM, clinical stage and pathology grade, 2 serial sections, 6 cases/24 cores
T023 1 Each

Esophagus carcer test tissue array, with normal esophagus tissue as control, including TNM, clinical stage and pathology grade, 2 serial sections, 6 cases/24 cores

Sign In for Pricing
View Details
G3BP2 rabbit pAb Antibody
orb765260-01 50 μL

G3BP2 rabbit pAb Antibody

Sign In for Pricing
View Details