Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL17A Rabbit Polyclonal Antibody (HRP)

IL17A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IL17, CTLA8, IL-17, CTLA-8, IL-17A

UniProt

Q16552

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human IL17A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLN

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

15kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002181

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytomegalovirus Glycoprotein B, Late Neutralizing Antigen (CMV gB, CMV Glycoprotein GP55, HCMV, Human Herpes virus 5, HHV-5, HHV5, UL55) (MaxLight 750) discontinued
C9100-21N-ML750 100 µL

Cytomegalovirus Glycoprotein B, Late Neutralizing Antigen (CMV gB, CMV Glycoprotein GP55, HCMV, Human Herpes virus 5, HHV-5, HHV5, UL55) (MaxLight 750) discontinued

Sign In for Pricing
View Details
PRELID2 3'UTR GFP Stable Cell Line
TU068789 1.0 mL

PRELID2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
ROR alpha (RORA) (NM_134261) Human Tagged ORF Clone Lentiviral Particle
RC202926L4V 200 µL

ROR alpha (RORA) (NM_134261) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
(S) -2,2'-Bis ((S) -4-isobutyl-4,5-dihydrooxazol-2-yl) -1,1'-binaphthalene
OR1059310-01 100 mg

(S) -2,2'-Bis ((S) -4-isobutyl-4,5-dihydrooxazol-2-yl) -1,1'-binaphthalene

Sign In for Pricing
View Details
(S) -2,2'-Bis ((S) -4-isobutyl-4,5-dihydrooxazol-2-yl) -1,1'-binaphthalene
OR1059310-02 250 mg

(S) -2,2'-Bis ((S) -4-isobutyl-4,5-dihydrooxazol-2-yl) -1,1'-binaphthalene

Sign In for Pricing
View Details
(S) -2,2'-Bis ((S) -4-isobutyl-4,5-dihydrooxazol-2-yl) -1,1'-binaphthalene
OR1059310-03 1 g

(S) -2,2'-Bis ((S) -4-isobutyl-4,5-dihydrooxazol-2-yl) -1,1'-binaphthalene

Sign In for Pricing
View Details