Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPATA2 Rabbit Polyclonal Antibody (Biotin)

SPATA2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PD1, tamo, PPP1R145

UniProt

Q9UM82

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SPATA2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DRLPHLHSKSKPSTTPTSRCGFCNRPGATNTCTQCSKVSCDACLSAYHYD

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001129245

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-Valine (Biotechnology Grade, High Purity)
B2010182 10 g

L-Valine (Biotechnology Grade, High Purity)

Sign In for Pricing
View Details
SNTB2 CRISPR Knock Out 293T Cell Line (Human)
45011141 1x 10^6 Cells / 1.0 mL

SNTB2 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (TP53/1799R), CF488A conjugate, 0.1mg/mL
BNC881799-500 1x 500 µL

P53 Tumor Suppressor Protein (TP53/1799R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IKZF3 cDNA Clone
MBS1274025-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

IKZF3 cDNA Clone

Sign In for Pricing
View Details
IKZF3 cDNA Clone
MBS1274025-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

IKZF3 cDNA Clone

Sign In for Pricing
View Details
Phospholipase C Eta 2 (PLCh2) Antibody
abx131479-01 100 µL

Phospholipase C Eta 2 (PLCh2) Antibody

Sign In for Pricing
View Details