Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPATA2 Rabbit Polyclonal Antibody (HRP)

SPATA2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PD1, tamo, PPP1R145

UniProt

Q9UM82

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SPATA2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DRLPHLHSKSKPSTTPTSRCGFCNRPGATNTCTQCSKVSCDACLSAYHYD

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001129245

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tctex1d1 (NM_001163767) Mouse Untagged Clone
MC210534 10 µg

Tctex1d1 (NM_001163767) Mouse Untagged Clone

Sign In for Pricing
View Details
Mouse Monoclonal Serpin A1/alpha 1-Antitrypsin Antibody (OTI9A1) [Alexa Fluor 700]
NBP2-74095AF700 0.1 mL

Mouse Monoclonal Serpin A1/alpha 1-Antitrypsin Antibody (OTI9A1) [Alexa Fluor 700]

Sign In for Pricing
View Details
GCLC Rabbit mAb
C06185-100uL*2 2x 100μL

GCLC Rabbit mAb

Sign In for Pricing
View Details
Anti-TRPC3 Antibody Picoband® Fluoro488 Conjugated
A01472-4-Fluoro488 100 µg/Vial

Anti-TRPC3 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
Recombinant FBJ murine osteosarcoma virus Envelope glycoprotein (env), partial
MBS1247450 Inquire

Recombinant FBJ murine osteosarcoma virus Envelope glycoprotein (env), partial

Sign In for Pricing
View Details
PHF21A, ID (PHF21A, BHC80, KIAA1696, PHD finger protein 21A, BHC80a, BRAF35-HDAC complex protein BHC80) (Biotin) discontinued
039949-Biotin 200 µL

PHF21A, ID (PHF21A, BHC80, KIAA1696, PHD finger protein 21A, BHC80a, BRAF35-HDAC complex protein BHC80) (Biotin) discontinued

Sign In for Pricing
View Details