Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HAVCR2 Rabbit Polyclonal Antibody (FITC)

HAVCR2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TIM3, CD366, KIM-3, SPTCL, TIMD3, Tim-3, TIMD-3, HAVcr-2

UniProt

Q8TDQ0

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human HAVCR2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: IGIYIGAGICAGLALALIFGALIFKWYSHSKEKIQNLSLISLANLPPSGL

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_116171

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHMP1A (CHMP1, KIAA0047, PCOLN3, PRSM1, Charged Multivesicular Body Protein 1a, Chromatin-modifying Protein 1a, Vacuolar Protein Sorting-associated Protein 46-1) (FITC)
MBS6373909-01 0.1 mL

CHMP1A (CHMP1, KIAA0047, PCOLN3, PRSM1, Charged Multivesicular Body Protein 1a, Chromatin-modifying Protein 1a, Vacuolar Protein Sorting-associated Protein 46-1) (FITC)

Sign In for Pricing
View Details
CHMP1A (CHMP1, KIAA0047, PCOLN3, PRSM1, Charged Multivesicular Body Protein 1a, Chromatin-modifying Protein 1a, Vacuolar Protein Sorting-associated Protein 46-1) (FITC)
MBS6373909-02 5x 0.1 mL

CHMP1A (CHMP1, KIAA0047, PCOLN3, PRSM1, Charged Multivesicular Body Protein 1a, Chromatin-modifying Protein 1a, Vacuolar Protein Sorting-associated Protein 46-1) (FITC)

Sign In for Pricing
View Details
Gzmg ORF Vector (Mouse) (pORF)
ORF046877 1.0 µg DNA

Gzmg ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Recombinant Ehrlichia ruminantium 10 kDa chaperonin (groS)
MBS1092186-01 0.02 mg (E-Coli)

Recombinant Ehrlichia ruminantium 10 kDa chaperonin (groS)

Sign In for Pricing
View Details
Recombinant Ehrlichia ruminantium 10 kDa chaperonin (groS)
MBS1092186-02 0.1 mg (E-Coli)

Recombinant Ehrlichia ruminantium 10 kDa chaperonin (groS)

Sign In for Pricing
View Details
Recombinant Ehrlichia ruminantium 10 kDa chaperonin (groS)
MBS1092186-03 0.02 mg (Yeast)

Recombinant Ehrlichia ruminantium 10 kDa chaperonin (groS)

Sign In for Pricing
View Details