Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HAVCR2 Rabbit Polyclonal Antibody (FITC)

HAVCR2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TIM3, CD366, KIM-3, SPTCL, TIMD3, Tim-3, TIMD-3, HAVcr-2

UniProt

Q8TDQ0

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human HAVCR2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: IGIYIGAGICAGLALALIFGALIFKWYSHSKEKIQNLSLISLANLPPSGL

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_116171

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Antitumor agent-110
HY-155541 1 Each

Antitumor agent-110

Sign In for Pricing
View Details
MAP2K1/2 Recombinant Rabbit mAb, BF647 conjugated
orb3164819 100 µL

MAP2K1/2 Recombinant Rabbit mAb, BF647 conjugated

Sign In for Pricing
View Details
MS4A6A (4SPAN3, CD20L3, MS4A6, Membrane-spanning 4-domains Subfamily A Member 6A, CD20 Antigen-like 3, Four-span Transmembrane Protein 3, MGC131944, MGC22650, MST090)
129912 100 µg

MS4A6A (4SPAN3, CD20L3, MS4A6, Membrane-spanning 4-domains Subfamily A Member 6A, CD20 Antigen-like 3, Four-span Transmembrane Protein 3, MGC131944, MGC22650, MST090)

Sign In for Pricing
View Details
Ephrin-A2 (EFNA2) Chicken ELISA Kit
D2053 96 Tests

Ephrin-A2 (EFNA2) Chicken ELISA Kit

Sign In for Pricing
View Details
PROCR Antibody
orb675939-01 50 µg

PROCR Antibody

Sign In for Pricing
View Details
PROCR Antibody
orb675939-02 100 µg

PROCR Antibody

Sign In for Pricing
View Details