Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPINB12 Rabbit Polyclonal Antibody (HRP)

SERPINB12 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

YUKOPIN

UniProt

Q96P63

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LGMVRLGARSDSAHQIDEVLHFNEFSQNESKEPDPCLKSNKQKAGSLNNE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human

Tested Applications

WB

NCBI Accession Number

NP_536722

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HEG1 activation kit by CRISPRa
GA111534 1 Kit

Human HEG1 activation kit by CRISPRa

Sign In for Pricing
View Details
HSV1 (Herpes Simplex Virus Type I) (HSVI/2095), CF488A conjugate, 0.1mg/mL
BNC882095-500 1x 500 µL

HSV1 (Herpes Simplex Virus Type I) (HSVI/2095), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HCV NS5B RdRp (1-19) Mouse Monoclonal Antibody [Clone ID: 8B2]
AM26121PU-N 100 µg

HCV NS5B RdRp (1-19) Mouse Monoclonal Antibody [Clone ID: 8B2]

Sign In for Pricing
View Details
Recombinant Human CXCL12 (24-88) protein (His Tag)
PKSH034169-01 20 µg

Recombinant Human CXCL12 (24-88) protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CXCL12 (24-88) protein (His Tag)
PKSH034169-02 100 µg

Recombinant Human CXCL12 (24-88) protein (His Tag)

Sign In for Pricing
View Details
PPP2R2B (110-139) Rabbit Polyclonal Antibody
AP18157PU-N 400 µL

PPP2R2B (110-139) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details