Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPINB13 Rabbit Polyclonal Antibody (HRP)

SERPINB13 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HUR7, PI13, headpin, HSHUR7SEQ

UniProt

Q9UIV8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SERPINB13

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MVYFKGQWDREFKKENTKEEKFWMNKSTSKSVQMMTQSHSFSFTFLEDLQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_036529

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-4 Protein, Mouse, Recombinant (Q136D, Y139D, His Tag)
E45M53440I2-20-ug 20 ug

IL-4 Protein, Mouse, Recombinant (Q136D, Y139D, His Tag)

Sign In for Pricing
View Details
OR11H4 Protein Vector (Human) (pPM-C-HA)
PV106036 500 ng

OR11H4 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Nucleocapsid Protein
PKSV030309-01 50 µg

Recombinant SARS-CoV-2 Nucleocapsid Protein

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Nucleocapsid Protein
PKSV030309-02 500 µg

Recombinant SARS-CoV-2 Nucleocapsid Protein

Sign In for Pricing
View Details
FZD9, NT (FZD9, FZD3, Frizzled-9, FzE6, CD349) (PE) discontinued
035823-PE 200 µL

FZD9, NT (FZD9, FZD3, Frizzled-9, FzE6, CD349) (PE) discontinued

Sign In for Pricing
View Details
TRNAG18 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV752019 1.0 µg DNA

TRNAG18 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details