Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP3 Rabbit Polyclonal Antibody (Biotin)

TIMP3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SFD, K222, K222TA2, HSMRK222

UniProt

P35625

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TIMP3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MTPWLGLIVLLGSWSLGDWGAEACTCSPSHPQDAFCNSDIVIRAKVVGKK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_000353

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEC13 (Protein SEC13 Homolog, SEC13-like Protein 1, SEC13-related Protein, D3S1231E, SEC13L1, SEC13R) (AP) discontinued
133078-AP 100 µL

SEC13 (Protein SEC13 Homolog, SEC13-like Protein 1, SEC13-related Protein, D3S1231E, SEC13L1, SEC13R) (AP) discontinued

Sign In for Pricing
View Details
Rat PTX3 (Pentraxin 3, Long) ELISA Kit
MBS8822067-01 48 Well

Rat PTX3 (Pentraxin 3, Long) ELISA Kit

Sign In for Pricing
View Details
Rat PTX3 (Pentraxin 3, Long) ELISA Kit
MBS8822067-02 96 Well

Rat PTX3 (Pentraxin 3, Long) ELISA Kit

Sign In for Pricing
View Details
Rat PTX3 (Pentraxin 3, Long) ELISA Kit
MBS8822067-03 5x 96 Well

Rat PTX3 (Pentraxin 3, Long) ELISA Kit

Sign In for Pricing
View Details
Rat PTX3 (Pentraxin 3, Long) ELISA Kit
MBS8822067-04 10x 96 Well

Rat PTX3 (Pentraxin 3, Long) ELISA Kit

Sign In for Pricing
View Details
CTGF, human recombinant
4702-1000 1 mg

CTGF, human recombinant

Sign In for Pricing
View Details