Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FXN, Mouse (P.pastoris, His)

FXN protein is a key activator in the core iron-sulfur cluster (ISC) assembly complex, accelerating persulfide transfer to ISCU and [2Fe-2S] cluster assembly. It promotes sulfur transfer, leading to oversulfidation and sulfide release. FXN Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived FXN protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

FXN Protein, Mouse (P.pastoris, His), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fxn-protein-mouse-p-pastoris-his.html

Smiles

LGTLDNPSSLDETAYERLAEETLDSLAEFFEDLADKPYTLEDYDVSFGDGVLTIKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLARELTKALNTKLDLSSLAYSGKGT

Molecular Formula

14297 (Gene_ID) O35943 (L78-T207) (Accession)

Molecular Weight

Approximately 16.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Benzydamine N-Oxide
TRC-B209960-25MG 25 mg

Benzydamine N-Oxide

Sign In for Pricing
View Details
Purified Anti-Human CD28 Antibody[CD28.2]
E-AB-F1195A-01 25 µg

Purified Anti-Human CD28 Antibody[CD28.2]

Sign In for Pricing
View Details
Purified Anti-Human CD28 Antibody[CD28.2]
E-AB-F1195A-02 100 µg

Purified Anti-Human CD28 Antibody[CD28.2]

Sign In for Pricing
View Details
MEX3A Antibody
KC-30045-01 50 μL

MEX3A Antibody

Sign In for Pricing
View Details
MEX3A Antibody
KC-30045-02 100 µL

MEX3A Antibody

Sign In for Pricing
View Details
MEX3A Antibody
KC-30045-03 1 mL

MEX3A Antibody

Sign In for Pricing
View Details