Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FXN, Mouse (P.pastoris, His)

FXN protein is a key activator in the core iron-sulfur cluster (ISC) assembly complex, accelerating persulfide transfer to ISCU and [2Fe-2S] cluster assembly. It promotes sulfur transfer, leading to oversulfidation and sulfide release. FXN Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived FXN protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

FXN Protein, Mouse (P.pastoris, His), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fxn-protein-mouse-p-pastoris-his.html

Smiles

LGTLDNPSSLDETAYERLAEETLDSLAEFFEDLADKPYTLEDYDVSFGDGVLTIKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLARELTKALNTKLDLSSLAYSGKGT

Molecular Formula

14297 (Gene_ID) O35943 (L78-T207) (Accession)

Molecular Weight

Approximately 16.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AASDH (NM_181806) Human Recombinant Protein
TP316923L 1 mg

AASDH (NM_181806) Human Recombinant Protein

Sign In for Pricing
View Details
Ap2m1 Mouse Gene Knockout Kit (CRISPR)
KN501362 1 Kit

Ap2m1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
C9orf89 (CARD19) Mouse Monoclonal Antibody [Clone ID: OTI3B3]
CF811305 100 µg

C9orf89 (CARD19) Mouse Monoclonal Antibody [Clone ID: OTI3B3]

Sign In for Pricing
View Details
EGFR (Epidermal Growth Factor Receptor) (F4), Biotin conjugate, 0.1mg/mL
BNCB2180-100 1x 100 µL

EGFR (Epidermal Growth Factor Receptor) (F4), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Gcnt1 activation kit by CRISPRa
GA201571 1 Kit

Mouse Gcnt1 activation kit by CRISPRa

Sign In for Pricing
View Details
2-(tert-Butyl)aniline
TRC-B809793-250MG 250 mg

2-(tert-Butyl)aniline

Sign In for Pricing
View Details