Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

A2M Rabbit Polyclonal Antibody (Biotin)

A2M Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

A2MD, CPAMD5, FWP007, S863-7

UniProt

P01023

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PVPGHVTVSICRKYSDASDCHGEDSQAFCEKFSGQLNSHGCFYQQVKTKV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

161kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

IHC, WB

NCBI Accession Number

NP_000005

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Cops5 shRNA (UAS) - Lentiviral mouse Cops5 shRNA (UAS, RFP) (25)
GTR15236387 1 Vial

Lentiviral mouse Cops5 shRNA (UAS) - Lentiviral mouse Cops5 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
SSA1, CT (Tripartite Motif-containing 21, 52kD Ribonucleoprotein Autoantigen Ro/SS-A, 52kD Ro Protein, RING Finger Protein 81, RNF81, Ro (SS-A), RO52, Sjoegren Syndrome Type A Antigen, SSA, SS-A, TRIM21, Tripartite Motif-containing Protein 21) discontinued
S6600-66C 50 µg

SSA1, CT (Tripartite Motif-containing 21, 52kD Ribonucleoprotein Autoantigen Ro/SS-A, 52kD Ro Protein, RING Finger Protein 81, RNF81, Ro (SS-A), RO52, Sjoegren Syndrome Type A Antigen, SSA, SS-A, TRIM21, Tripartite Motif-containing Protein 21) discontinued

Sign In for Pricing
View Details
SLC22A7 Rabbit Polyclonal Antibody (FITC)
orb2122425 100 µL

SLC22A7 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Recombinant Mouse T-cell receptor gamma chain V region V108A
MBS1254203-01 0.02 mg (E-Coli)

Recombinant Mouse T-cell receptor gamma chain V region V108A

Sign In for Pricing
View Details
Recombinant Mouse T-cell receptor gamma chain V region V108A
MBS1254203-02 0.1 mg (E-Coli)

Recombinant Mouse T-cell receptor gamma chain V region V108A

Sign In for Pricing
View Details
Recombinant Mouse T-cell receptor gamma chain V region V108A
MBS1254203-03 0.02 mg (Yeast)

Recombinant Mouse T-cell receptor gamma chain V region V108A

Sign In for Pricing
View Details