Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC26 Rabbit Polyclonal Antibody (Biotin)

CDC26 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

APC12, ANAPC12, C9orf17

UniProt

Q8NHZ8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CDC26

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

10kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_644815

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti Rat ACE2 Polyclonal Affinity Purified
MBS8421221-01 0.1 mg

Rabbit Anti Rat ACE2 Polyclonal Affinity Purified

Sign In for Pricing
View Details
Rabbit Anti Rat ACE2 Polyclonal Affinity Purified
MBS8421221-02 5x 0.1 mg

Rabbit Anti Rat ACE2 Polyclonal Affinity Purified

Sign In for Pricing
View Details
Lentiviral mouse Dppa1 shRNA (UAS) - Lentiviral mouse Dppa1 shRNA (UAS, RFP) (100)
GTR15228960 1 Vial

Lentiviral mouse Dppa1 shRNA (UAS) - Lentiviral mouse Dppa1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Chromobox protein homolog 8 (CBX8) Mouse ELISA Kit
C3611 96 Tests

Chromobox protein homolog 8 (CBX8) Mouse ELISA Kit

Sign In for Pricing
View Details
ELAC1, NT (ELAC1, D29, Zinc phosphodiesterase ELAC protein 1, Deleted in Ma29, ElaC homolog protein 1, Ribonuclease Z 1, tRNA 3 endonuclease 1, tRNase Z 1) (MaxLight 650)
MBS6295179-01 0.1 mL

ELAC1, NT (ELAC1, D29, Zinc phosphodiesterase ELAC protein 1, Deleted in Ma29, ElaC homolog protein 1, Ribonuclease Z 1, tRNA 3 endonuclease 1, tRNase Z 1) (MaxLight 650)

Sign In for Pricing
View Details
ELAC1, NT (ELAC1, D29, Zinc phosphodiesterase ELAC protein 1, Deleted in Ma29, ElaC homolog protein 1, Ribonuclease Z 1, tRNA 3 endonuclease 1, tRNase Z 1) (MaxLight 650)
MBS6295179-02 5x 0.1 mL

ELAC1, NT (ELAC1, D29, Zinc phosphodiesterase ELAC protein 1, Deleted in Ma29, ElaC homolog protein 1, Ribonuclease Z 1, tRNA 3 endonuclease 1, tRNase Z 1) (MaxLight 650)

Sign In for Pricing
View Details