Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC27 Rabbit Polyclonal Antibody (FITC)

CDC27 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

APC3, HNUC, NUC2, H-NUC, ANAPC3, CDC27Hs, D0S1430E, D17S978E

UniProt

P30260

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human CDC27

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SYIDSAVISPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001107563.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Pyruvate Kinase, Muscle (PKM2) ELISA Kit
MBS4501878-01 48 Tests

Mouse Pyruvate Kinase, Muscle (PKM2) ELISA Kit

Sign In for Pricing
View Details
Mouse Pyruvate Kinase, Muscle (PKM2) ELISA Kit
MBS4501878-02 96 Tests

Mouse Pyruvate Kinase, Muscle (PKM2) ELISA Kit

Sign In for Pricing
View Details
Mouse Pyruvate Kinase, Muscle (PKM2) ELISA Kit
MBS4501878-03 5x 96 Tests

Mouse Pyruvate Kinase, Muscle (PKM2) ELISA Kit

Sign In for Pricing
View Details
Mouse Pyruvate Kinase, Muscle (PKM2) ELISA Kit
MBS4501878-04 10x 96 Tests

Mouse Pyruvate Kinase, Muscle (PKM2) ELISA Kit

Sign In for Pricing
View Details
PIC M028-Dia 200-PE-CRD/1 Electrical & Equipment Safety Signs & Labels (Adhesive)
831005 1 Card (1 Panel (s) x 1 Card)

PIC M028-Dia 200-PE-CRD/1 Electrical & Equipment Safety Signs & Labels (Adhesive)

Sign In for Pricing
View Details
Lentiviral human PXMP4 shRNA (UAS) - Lentiviral human PXMP4 shRNA (UAS) (100)
GTR15142326 1 Vial

Lentiviral human PXMP4 shRNA (UAS) - Lentiviral human PXMP4 shRNA (UAS) (100)

Sign In for Pricing
View Details