Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OTUB2 Rabbit Polyclonal Antibody (Biotin)

OTUB2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

OTB2, OTU2, C14orf137

UniProt

Q96DC9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human OTUB2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EEHKFRNFFNAFYSVVELVEKDGSVSSLLKVFNDQSASDHIVQFLRLLTS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_075601

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

10,12-Pentacosadiynoic Acid Ethyl-d5 Ester
411701-01 10 mg

10,12-Pentacosadiynoic Acid Ethyl-d5 Ester

Sign In for Pricing
View Details
10,12-Pentacosadiynoic Acid Ethyl-d5 Ester
411701-02 100 mg

10,12-Pentacosadiynoic Acid Ethyl-d5 Ester

Sign In for Pricing
View Details
HDGF shRNA (m) Lentiviral Particles
sc-45879-V 200 µL

HDGF shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Human Anti-parainfluenza virus IgG antibody (PIV-Ab-IgG) ELISA Kit
AE62357HU-01 48 Tests

Human Anti-parainfluenza virus IgG antibody (PIV-Ab-IgG) ELISA Kit

Sign In for Pricing
View Details
Human Anti-parainfluenza virus IgG antibody (PIV-Ab-IgG) ELISA Kit
AE62357HU-02 96 Tests

Human Anti-parainfluenza virus IgG antibody (PIV-Ab-IgG) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human DENND4B sgRNA gene knockout kit - Lentiviral human DENND4B sgRNA gene knockout kit (25)
GTR15359724 1 Vial

Lentiviral human DENND4B sgRNA gene knockout kit - Lentiviral human DENND4B sgRNA gene knockout kit (25)

Sign In for Pricing
View Details