Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OTUB2 Rabbit Polyclonal Antibody (HRP)

OTUB2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OTB2, OTU2, C14orf137

UniProt

Q96DC9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human OTUB2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EEHKFRNFFNAFYSVVELVEKDGSVSSLLKVFNDQSASDHIVQFLRLLTS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_075601

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human recombinant EGF (Epidermal growth factor) protein, AF
PROTP01133-5-1mg 1 mg

Human recombinant EGF (Epidermal growth factor) protein, AF

Sign In for Pricing
View Details
VHL Antibody
OAAF01679-100UG 100 µg

VHL Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal Carboxypeptidase A2/CPA2 Antibody (133) [Janelia Fluor 646]
NBP2-90716JF646 0.1 mL

Rabbit Monoclonal Carboxypeptidase A2/CPA2 Antibody (133) [Janelia Fluor 646]

Sign In for Pricing
View Details
CENP-Q (His-tag) Human Protein
AR51301PU-S 100 µg

CENP-Q (His-tag) Human Protein

Sign In for Pricing
View Details
Human Galectin 9 (GAL9) ELISA kit
YLA1983HU-01 48 Tests

Human Galectin 9 (GAL9) ELISA kit

Sign In for Pricing
View Details
Human Galectin 9 (GAL9) ELISA kit
YLA1983HU-02 96 Tests

Human Galectin 9 (GAL9) ELISA kit

Sign In for Pricing
View Details