Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OTUB2 Rabbit Polyclonal Antibody (HRP)

OTUB2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OTB2, OTU2, C14orf137

UniProt

Q96DC9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human OTUB2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EEHKFRNFFNAFYSVVELVEKDGSVSSLLKVFNDQSASDHIVQFLRLLTS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_075601

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ccpg1 Rat shRNA Lentiviral Particle (Locus ID 363098)
TL707300V 500 µL Each

Ccpg1 Rat shRNA Lentiviral Particle (Locus ID 363098)

Sign In for Pricing
View Details
Ubiquitin D Rabbit pAb, IRDye 800CW conjugated
orb2819662 100 µL

Ubiquitin D Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
Difluoromethyl 2,2,3,3-tetrafluoropropyl ether
sc-300456B 100 g

Difluoromethyl 2,2,3,3-tetrafluoropropyl ether

Sign In for Pricing
View Details
TBP, CT (TATA-box-binding Protein, TATA-box Factor, TATA-binding Factor, TATA Sequence-binding Protein, Transcription Initiation Factor TFIID TBP Subunit, TFIID, TF2D, GTF2D1) (MaxLight 650) discontinued
T0700-90A-ML650 100 µL

TBP, CT (TATA-box-binding Protein, TATA-box Factor, TATA-binding Factor, TATA Sequence-binding Protein, Transcription Initiation Factor TFIID TBP Subunit, TFIID, TF2D, GTF2D1) (MaxLight 650) discontinued

Sign In for Pricing
View Details
WDFY3 Rabbit Polyclonal Antibody (APC)
orb992330 100 µL

WDFY3 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Rabbit Polyclonal FTSJD2 Antibody
NBP1-83046-25ul 25 µL

Rabbit Polyclonal FTSJD2 Antibody

Sign In for Pricing
View Details