Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UCHL1 Rabbit Polyclonal Antibody (HRP)

UCHL1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q00981

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat UCHL1.

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NNQDKLEFEDGSVLKQFLSETEKLSPEDRAKCFEKNEAIQAAHDSVAQEG

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_058933

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZC3H15, CT (ZC3H15, DFRP1, LEREPO4, Zinc finger CCCH domain-containing protein 15, DRG family-regulatory protein 1, Likely ortholog of mouse immediate early response erythropoietin 4) (MaxLight 650) discontinued
044018-ML650 100 µL

ZC3H15, CT (ZC3H15, DFRP1, LEREPO4, Zinc finger CCCH domain-containing protein 15, DRG family-regulatory protein 1, Likely ortholog of mouse immediate early response erythropoietin 4) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Rabbit anti-human AFG3-like protein 2 polyclonal Antibody, HRP conjugated
MBS715540-01 0.05 mg

Rabbit anti-human AFG3-like protein 2 polyclonal Antibody, HRP conjugated

Sign In for Pricing
View Details
Rabbit anti-human AFG3-like protein 2 polyclonal Antibody, HRP conjugated
MBS715540-02 0.1 mg

Rabbit anti-human AFG3-like protein 2 polyclonal Antibody, HRP conjugated

Sign In for Pricing
View Details
Rabbit anti-human AFG3-like protein 2 polyclonal Antibody, HRP conjugated
MBS715540-03 5x 0.1 mg

Rabbit anti-human AFG3-like protein 2 polyclonal Antibody, HRP conjugated

Sign In for Pricing
View Details
DDX11L8 Adenovirus (Human)
17806051 1.0 mL

DDX11L8 Adenovirus (Human)

Sign In for Pricing
View Details
Ankrd33 AAV siRNA Pooled Vector
11985164 1.0 µg

Ankrd33 AAV siRNA Pooled Vector

Sign In for Pricing
View Details