Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UCHL5 Rabbit Polyclonal Antibody (HRP)

UCHL5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

UCH37, CGI-70, INO80R, UCH-L5

UniProt

Q9Y5K5

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human UCHL5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQNAKKAQETK

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057068

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAD51L3 (1-328, His-tag) Human Protein
AR51365PU-N 100 µg

RAD51L3 (1-328, His-tag) Human Protein

Sign In for Pricing
View Details
IFluor® 820 Anti-human CD3 Antibody *HIT3a*
100300P1-AAT 500 Tests

IFluor® 820 Anti-human CD3 Antibody *HIT3a*

Sign In for Pricing
View Details
SGIP1 shRNA (m) Lentiviral Particles
sc-153416-V 200 µL

SGIP1 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Recombinant Mouse A disintegrin and metalloproteinase with thrombospondin motifs 13 (Adamts13) , partial
MBS1385749-01 0.02 mg (E-Coli)

Recombinant Mouse A disintegrin and metalloproteinase with thrombospondin motifs 13 (Adamts13) , partial

Sign In for Pricing
View Details
Recombinant Mouse A disintegrin and metalloproteinase with thrombospondin motifs 13 (Adamts13) , partial
MBS1385749-02 0.02 mg (Mammalian-Cell)

Recombinant Mouse A disintegrin and metalloproteinase with thrombospondin motifs 13 (Adamts13) , partial

Sign In for Pricing
View Details
Recombinant Mouse A disintegrin and metalloproteinase with thrombospondin motifs 13 (Adamts13) , partial
MBS1385749-03 0.1 mg (E-Coli)

Recombinant Mouse A disintegrin and metalloproteinase with thrombospondin motifs 13 (Adamts13) , partial

Sign In for Pricing
View Details