Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UCHL5 Rabbit Polyclonal Antibody (Biotin)

UCHL5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

UCH37, CGI-70, INO80R, UCH-L5

UniProt

Q9Y5K5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human UCHL5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGA

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057068

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Coelenterazine hcp
T36847 1 mg

Coelenterazine hcp

Sign In for Pricing
View Details
BCL2A1, ID (BCL2A1, BCL2L5, BFL1, GRS, HBPA1, Bcl-2-related protein A1, Bcl-2-like protein 5, Hemopoietic-specific early response protein, Protein BFL-1, Protein GRS) (MaxLight 650) discontinued
032467-ML650 100 µL

BCL2A1, ID (BCL2A1, BCL2L5, BFL1, GRS, HBPA1, Bcl-2-related protein A1, Bcl-2-like protein 5, Hemopoietic-specific early response protein, Protein BFL-1, Protein GRS) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Phospho-BTK (Tyr223) Rabbit Polyclonal Antibody (BF680)
orb1584090 100 µL

Phospho-BTK (Tyr223) Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
(S) -6,7-Dihydro-2-nitro-6-[[4- (trifluoromethoxy) phenyl]methoxy]-5H-imidazo[2,1-b][1,3]oxazine
FP26721-01 0.1 g

(S) -6,7-Dihydro-2-nitro-6-[[4- (trifluoromethoxy) phenyl]methoxy]-5H-imidazo[2,1-b][1,3]oxazine

Sign In for Pricing
View Details
(S) -6,7-Dihydro-2-nitro-6-[[4- (trifluoromethoxy) phenyl]methoxy]-5H-imidazo[2,1-b][1,3]oxazine
FP26721-02 0.25 g

(S) -6,7-Dihydro-2-nitro-6-[[4- (trifluoromethoxy) phenyl]methoxy]-5H-imidazo[2,1-b][1,3]oxazine

Sign In for Pricing
View Details
N4, N4,2-Trimethyl-N1, N1-di (pentan-3-yl) benzene-1,4-diamine
460381-01 500 mg

N4, N4,2-Trimethyl-N1, N1-di (pentan-3-yl) benzene-1,4-diamine

Sign In for Pricing
View Details