Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UCHL5 Rabbit Polyclonal Antibody (HRP)

UCHL5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

UCH37, CGI-70, INO80R, UCH-L5

UniProt

Q9Y5K5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human UCHL5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGA

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057068

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Breast
CS623220 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS634249 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Anillin (ANLN) Human Gene Knockout Kit (CRISPR)
KN416272 1 Kit

Anillin (ANLN) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Junctophilin 2 (JPH2) (C-term) Rabbit Polyclonal Antibody
AP23013PU-N 50 µg

Junctophilin 2 (JPH2) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Adiponectin (Marker of Obesity) (ADPN/1370), Biotin conjugate, 0.1mg/mL
BNCB1370-100 1x 100 µL

Adiponectin (Marker of Obesity) (ADPN/1370), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cellular Apoptosis Susceptibility Recombinant Rabbit Monoclonal Antibody [JU34-33]
ET7106-90 100 µL

Cellular Apoptosis Susceptibility Recombinant Rabbit Monoclonal Antibody [JU34-33]

Sign In for Pricing
View Details