Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Uchl3 Rabbit Polyclonal Antibody (HRP)

Uchl3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9JKB1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Uchl3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IHAIANNKDKMHFESGSTLKKFLEESVSMSPEERAKFLENYDAIRVTHET

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_057932

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Ephrin Receptor B3 Antibody
RC-16739-01 50 μL

Recombinant Ephrin Receptor B3 Antibody

Sign In for Pricing
View Details
Recombinant Ephrin Receptor B3 Antibody
RC-16739-02 100 µL

Recombinant Ephrin Receptor B3 Antibody

Sign In for Pricing
View Details
Recombinant Ephrin Receptor B3 Antibody
RC-16739-03 1 mL

Recombinant Ephrin Receptor B3 Antibody

Sign In for Pricing
View Details
Cdc20 (CDC20/1102), CF488A conjugate, 0.1mg/mL
BNC881102-100 1x 100 µL

Cdc20 (CDC20/1102), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Citraconic Acid
TRC-C520518-250MG 250 mg

Citraconic Acid

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1373), CF640R conjugate, 0.1mg/mL
BNC401373-100 1x 100 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1373), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details