Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Usp10 Rabbit Polyclonal Antibody (Biotin)

Usp10 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MGC124997

UniProt

Q3KR59

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RDIRPGAAFEPTYIYRLLTVIKSSLSEKGRQEDAEEYLGFILNGLHEEML

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

87kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001029318

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAPK13 (Mitogen-activated Protein Kinase 13, MAPK 13, MAP Kinase 13, PRKM13, Mitogen-activated Protein Kinase p38 delta, MAP Kinase p38 delta, p38delta, Stress-activated Protein Kinase 4, SAPK4, MGC99536) (MaxLight 550)
129401-ML550 100 µL

MAPK13 (Mitogen-activated Protein Kinase 13, MAPK 13, MAP Kinase 13, PRKM13, Mitogen-activated Protein Kinase p38 delta, MAP Kinase p38 delta, p38delta, Stress-activated Protein Kinase 4, SAPK4, MGC99536) (MaxLight 550)

Sign In for Pricing
View Details
GNB5 Rabbit pAb, PE-Cy7 conjugated
orb2840967 100 µL

GNB5 Rabbit pAb, PE-Cy7 conjugated

Sign In for Pricing
View Details
Lamin B1 Recombinant Rabbit mAb, PerCP-Cy7 conjugated
orb2978717 100 µL

Lamin B1 Recombinant Rabbit mAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
LINC00469 Protein Vector (Human) (pPB-N-His)
PV054362 500 ng

LINC00469 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Hsa-miR-15b-3p antagomir
HY-RI00320A-01 5 nmol

Hsa-miR-15b-3p antagomir

Sign In for Pricing
View Details
Hsa-miR-15b-3p antagomir
HY-RI00320A-02 20 nmol

Hsa-miR-15b-3p antagomir

Sign In for Pricing
View Details