Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP46 Rabbit Polyclonal Antibody (HRP)

USP46 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

P62068

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human UBP46

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RDFSNTETLCSEQKYYCETCCSKQEAQKRMRVKKLPMILALHLKRFKYME

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Charged multivesicular body Protein 2a (HRP)
310628-01 50 µg

Charged multivesicular body Protein 2a (HRP)

Sign In for Pricing
View Details
Charged multivesicular body Protein 2a (HRP)
310628-02 100 µg

Charged multivesicular body Protein 2a (HRP)

Sign In for Pricing
View Details
RANBP10 Antibody
orb2678202-01 50 µL

RANBP10 Antibody

Sign In for Pricing
View Details
RANBP10 Antibody
orb2678202-02 100 µL

RANBP10 Antibody

Sign In for Pricing
View Details
RANBP10 Antibody
orb2678202-03 200 µL

RANBP10 Antibody

Sign In for Pricing
View Details
Human H2A Histone Family, Member X (H2AFX) ELISA Kit
MBS2707204-01 24 Strip Well

Human H2A Histone Family, Member X (H2AFX) ELISA Kit

Sign In for Pricing
View Details