Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP6 Rabbit Polyclonal Antibody (Biotin)

USP6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HRP1, TRE2, TRE17, Tre-2, TRESMCR, USP6-short

UniProt

P35125

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human USP6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NHSEEDSTDDQREDTHIKPIYNLYAISCHSGILSGGHYITYAKNPNCKWY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

119kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR110 (ADGRF1) (NM_025048) Human Tagged ORF Clone Lentiviral Particle
RC219437L4V 200 µL

GPR110 (ADGRF1) (NM_025048) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
IRAK4 (Interleukin-1 Receptor-Associated Kinase 4, IPD1, NY-REN-64, REN64) (MaxLight 405)
MBS6196295-01 0.1 mL

IRAK4 (Interleukin-1 Receptor-Associated Kinase 4, IPD1, NY-REN-64, REN64) (MaxLight 405)

Sign In for Pricing
View Details
IRAK4 (Interleukin-1 Receptor-Associated Kinase 4, IPD1, NY-REN-64, REN64) (MaxLight 405)
MBS6196295-02 5x 0.1 mL

IRAK4 (Interleukin-1 Receptor-Associated Kinase 4, IPD1, NY-REN-64, REN64) (MaxLight 405)

Sign In for Pricing
View Details
Mouse IgG Lyophilized
B2013604 25 mg

Mouse IgG Lyophilized

Sign In for Pricing
View Details
Human anti-Bactericidal permeability increasing protein antibody, BPI-Ab ELISA Kit
GTR10458244 96 Well

Human anti-Bactericidal permeability increasing protein antibody, BPI-Ab ELISA Kit

Sign In for Pricing
View Details
CCM2 Protein Vector (Mouse) (pPM-C-His)
PV162841 500 ng

CCM2 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details