Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP6 Rabbit Polyclonal Antibody (FITC)

USP6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HRP1, TRE2, TRE17, Tre-2, TRESMCR, USP6-short

UniProt

P35125

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human USP6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NHSEEDSTDDQREDTHIKPIYNLYAISCHSGILSGGHYITYAKNPNCKWY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

119kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human CFP sgRNA gene knockout kit - Lentiviral human CFP sgRNA gene knockout kit (plasmid)
GTR15397826 1 Vial

Lentiviral human CFP sgRNA gene knockout kit - Lentiviral human CFP sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
ISG20 (Interferon-stimulated Gene 20kD Protein, Estrogen-regulated Transcript 45 Protein, Promyelocytic Leukemia Nuclear Body-associated Protein ISG20)
128605 100 µg

ISG20 (Interferon-stimulated Gene 20kD Protein, Estrogen-regulated Transcript 45 Protein, Promyelocytic Leukemia Nuclear Body-associated Protein ISG20)

Sign In for Pricing
View Details
Phospho-JNK1 + 2 + 3 (Thr183+Tyr185) Rabbit Polyclonal Antibody (BF647)
orb1586854 100 µL

Phospho-JNK1 + 2 + 3 (Thr183+Tyr185) Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
Anti-TTC6 Antibody
CTA2470-01 30 µL

Anti-TTC6 Antibody

Sign In for Pricing
View Details
Anti-TTC6 Antibody
CTA2470-02 50 μL

Anti-TTC6 Antibody

Sign In for Pricing
View Details
Anti-TTC6 Antibody
CTA2470-03 100 µL

Anti-TTC6 Antibody

Sign In for Pricing
View Details